425Aa Long Hypothetical Proton Glutamate Symport Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 425Aa Long Hypothetical Proton Glutamate Symport Protein
  Conformer 1
(PDB)
2nww (B)
  Conformer 2
(PDB)
3kbc (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 232 3.54   81 - 124   227 - 414
2 171 2.78   12 - 80   125 - 226

Sequence


           _______________________________________________________________70___________________________________________________124_ 
 2nww(B) : ****YPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPH 
         :                                                                                                                          
 3kbc(B) : KYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLCMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPH 
           _______________________________________________________________70___________________________________________________124_ 

           _____________________________________________________________________________________________221________________________ 
 2nww(B) : QAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILL 
         :                                                                                                                          
 3kbc(B) : QAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILL 
           _____________________________________________________________________________________________221________________________ 

           ________________________________________________________________________________________________________________________ 
 2nww(B) : VYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAM 
         :                                                                                                                          
 3kbc(B) : VYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVATFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLCM 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________________                                                                      
 2nww(B) : VLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTE                                                                      
         :                                                                                                                          
 3kbc(B) : VLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTE                                                                      
           ___________________________________________________                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
40.1
Translation
(A)
8.3
Closure
(%)
87.8
Bending Residues
( green )
  70 - 81
  124 - 126
  221 - 227
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download