Acrb

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Acrb
  Conformer 1
(PDB)
2dhh (A)
  Conformer 2
(PDB)
2dhh (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 206 1.86   39 - 129   619 - 621   624 - 625   670 - 726   813 - 814   816 - 866
2 375 2.07   4 - 38   344 - 564   867 - 920   925 - 985   1016 - 1033
3 135 1.8   139 - 182   289 - 343   565 - 566   921 - 924   986 - 1015
4 291 1.1   183 - 288   567 - 618   622 - 623   626 - 669   727 - 812   815 - 815

Sequence


           ____________________________________38__________________________________________________________________________________ 
 2dhh(A) : MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQ 
         :                                                                                                                          
 2dhh(B) : MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQ 
           ____________________________________38__________________________________________________________________________________ 

           ______129__________________________________________________182__________________________________________________________ 
 2dhh(A) : EVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGTPPVKGQQLNASIIAQTRL 
         :                                                                                                                          
 2dhh(B) : EVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGTPPVKGQQLNASIIAQTRL 
           ______129__________________________________________________182__________________________________________________________ 

           _____________________________________________288__________________________________________________341___________________ 
 2dhh(A) : TSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYLFLQ 
         :                                                                                                                          
 2dhh(B) : TSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYLFLQ 
           _____________________________________________288__________________________________________________341___________________ 

           ________________________________________________________________________________________________________________________ 
 2dhh(A) : NFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL 
         :                                                                                                                          
 2dhh(B) : NFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________________________________564_______________________________________________614 
 2dhh(A) : SVLVALILTPALCATMLKfGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNG 
         :                                                                                                                          
 2dhh(B) : SVLVALILTPALCATMLKfGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNG 
           ___________________________________________________________________564_______________________________________________614 

           ____________________________________________________669______________________________________________________726________ 
 2dhh(A) : FGFAGRGQNTGIAFVSLKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQE 
         :                                                                                                                          
 2dhh(B) : FGFAGRGQNTGIAFVSLKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQE 
           ____________________________________________________669______________________________________________________726________ 

           ___________________________________________________________________________812__________________________________________ 
 2dhh(A) : KAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTG 
         :                                                                                                                          
 2dhh(B) : KAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTG 
           ___________________________________________________________________________812__________________________________________ 

           _________866___________________________________________________920_924__________________________________________________ 
 2dhh(A) : VGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRP 
         :                                                                                                                          
 2dhh(B) : VGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRP 
           _________866___________________________________________________920_924__________________________________________________ 

           ________985__________________________1015_____________________                                                           
 2dhh(A) : ILMTSLAFILGVMPLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRK                                                           
         :                                                                                                                          
 2dhh(B) : ILMTSLAFILGVMPLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRK                                                           
           ________985__________________________1015_____________________                                                           

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 20.6 1.0 40.2   38 - 39   866 - 867 Bending Region Analysis
1 3 17.4 -5.6 62.8   129 - 139 Bending Region Analysis
1 4 18.8 -0.6 92.3   614 - 626   669 - 679   726 - 727   812 - 816 Bending Region Analysis
3 2 16.6 1.0 1.7   341 - 344   564 - 565   920 - 921   924 - 925   985 - 994   1015 - 1016 Bending Region Analysis
3 4 13.8 -0.2 30.5   182 - 183   288 - 289   566 - 567 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 3

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download