Alcohol Dehydrogenase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Alcohol Dehydrogenase
  Conformer 1
(PDB)
1ju9 (B)
  Conformer 2
(PDB)
1hld (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 237 0.78   3 - 177   293 - 300   319 - 372
2 133 0.35   178 - 292   301 - 318

Sequence


           ________________________________________________________________________________________________________________________ 
 1ju9(B) : STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPR 
         :                                                                                                                          
 1hld(B) : STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPR 
           ________________________________________________________________________________________________________________________ 

           ______________________________________________________177_______________________________________________________________ 
 1ju9(B) : GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC 
         :                                                                                                                          
 1hld(B) : GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC 
           ______________________________________________________177_______________________________________________________________ 

           ______________________________________________289__________________________318__________________________________________ 
 1ju9(B) : VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVISGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD 
         :                                                                                                                          
 1hld(B) : VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD 
           ______________________________________________289__________________________318__________________________________________ 

           ______________                                                                                                           
 1ju9(B) : LLRSGESIRTILTF                                                                                                           
         :                                                                                                                          
 1hld(B) : LLRSGESIRTILTF                                                                                                           
           ______________                                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
9.0
Translation
(A)
-0.2
Closure
(%)
96.9
Bending Residues
( green )
  177 - 178
  289 - 301
  318 - 319
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download