Alcohol Dehydrogenase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Alcohol Dehydrogenase
  Conformer 1
(PDB)
1cdo (A)
  Conformer 2
(PDB)
1cdo (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 228 0.52   3 - 177   320 - 372
2 142 0.32   178 - 319

Sequence


           ________________________________________________________________________________________________________________________ 
 1cdo(A) : ATVGKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVLGHEGAGIVESVGPGVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANES 
         :                                                                                                                          
 1cdo(B) : ATVGKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVLGHEGAGIVESVGPGVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANES 
           ________________________________________________________________________________________________________________________ 

           ______________________________________________________177_______________________________________________________________ 
 1cdo(A) : PDVMSPKETRFTCKGRKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAKVEPGSTCAVFGLGAVGLAAVMGCHSAGAKRIIAVDLNPDKFEKAKVFGATD 
         :                                                                                                                          
 1cdo(B) : PDVMSPKETRFTCKGRKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAKVEPGSTCAVFGLGAVGLAAVMGCHSAGAKRIIAVDLNPDKFEKAKVFGATD 
           ______________________________________________________177_______________________________________________________________ 

           ____________________________________________________________________________319_________________________________________ 
 1cdo(A) : FVNPNDHSEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDVATRPIQLIAGRTWKGSMFGGFKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAID 
         :                                                                                                                          
 1cdo(B) : FVNPNDHSEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDVATRPIQLIAGRTWKGSMFGGFKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAID 
           ____________________________________________________________________________319_________________________________________ 

           ______________                                                                                                           
 1cdo(A) : LMKHGKCIRTVLSL                                                                                                           
         :                                                                                                                          
 1cdo(B) : LMKHGKCIRTVLSL                                                                                                           
           ______________                                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
7.0
Translation
(A)
-0.1
Closure
(%)
98.2
Bending Residues
( green )
  177 - 178
  319 - 320
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download