Aldose Reductase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Aldose Reductase
  Conformer 1
(PDB)
1xgd (A)
  Conformer 2
(PDB)
1ef3 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 253 0.72   4 - 211   254 - 257   267 - 277   284 - 313
2 57 2.99   212 - 253   258 - 266   278 - 283

Sequence


           ________________________________________________________________________________________________________________________ 
 1xgd(A) : ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKE 
         :                                                                                                                          
 1ef3(A) : ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKE 
           ________________________________________________________________________________________________________________________ 

           ______________________________________________________________________________________209_______________________________ 
 1xgd(A) : FFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKH 
         :                                                                                                                          
 1ef3(A) : FFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKH 
           ______________________________________________________________________________________209_______________________________ 

           __________253_257______266________277___283________________________________                                              
 1xgd(A) : NKTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF                                              
         :                                                                                                                          
 1ef3(A) : NKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF                                              
           __________253_257______266________277___283________________________________                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
19.4
Translation
(A)
-0.5
Closure
(%)
85.3
Bending Residues
( green )
  209 - 212
  253 - 254
  257 - 258
  266 - 271
  277 - 278
  283 - 284
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download