Aspartate Carbamoyltransferase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Aspartate Carbamoyltransferase
  Conformer 1
(PDB)
1gq3 (A)
  Conformer 2
(PDB)
2atc (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 256 2.54   5 - 215   246 - 303
2 22 9.88   216 - 245

Sequence


           ________________________________________________________________________________________________________________________ 
 1gq3(A) : ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDS--------gETLADTISVISTYVDAIVMAHPQEGAARLATEFSG 
         :                                                                                                                          
 2atc(A) : ANPLYQSHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFQTSMHRLGASVVGFSDSANTSLGKKGQTLANTISVISTYVDAIVMRHPQEGAARLATEFSG 
           ________________________________________________________________________________________________________________________ 

           ____________________________________________________________________________________________215_________________________ 
 1gq3(A) : NVPVLNAG-----hPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY 
         :                                                                                                                          
 2atc(A) : NVPVLNAGDGSNQHPTQTLLDLFTIQQTEGRLNNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPEYILDMLDEKGIAWSLHSSIEEVM--------TRVQKERLDPSEY 
           ____________________________________________________________________________________________215_________________________ 

           __245____________________________________________________________________                                                
 1gq3(A) : ANVKAQFVLRASDL---HNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQALLALVLNRD***                                                
         :                                                                                                                          
 2atc(A) : AXVKAQFLVRANSLGGLHNAKMNAKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQALLALVLNRDLVL                                                
           __235____________________________________________________________________                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
64.8
Translation
(A)
2.0
Closure
(%)
94.2
Bending Residues
( green )
  215 - 216
  245 - 258
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download