Atp-Dependent Hsl Protease Atp-Binding Subunit Hslu

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Atp-Dependent Hsl Protease Atp-Binding Subunit Hslu
  Conformer 1
(PDB)
1yyf (A)
  Conformer 2
(PDB)
1yyf (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 169 0.18   3 - 51   54 - 96   252 - 325   392 - 394
2 115 0.16   52 - 53   326 - 391   395 - 441
3 120 0.18   97 - 251

Sequence


           _________________________________________________51__________________________________________95_________________________ 
 1yyf(A) : MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNR 
         :                                                                                                                          
 1yyf(B) : MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNR 
           _________________________________________________51__________________________________________95_________________________ 

           ___________________________________________________________________________________________249__________________________ 
 1yyf(A) : YRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEkQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSRE 
         :                                                                                                                          
 1yyf(B) : YRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEkQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSRE 
           ___________________________________________________________________________________________249__________________________ 

           _______________________________________________325_______________________________________________________________391____ 
 1yyf(A) : GVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRL 
         :                                                                                                                          
 1yyf(B) : GVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRL 
           _______________________________________________325_______________________________________________________________391____ 

           ________________________________________________                                                                         
 1yyf(A) : HTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL                                                                         
         :                                                                                                                          
 1yyf(B) : HTVLERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL                                                                         
           ________________________________________________                                                                         

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
1.8
Translation
(A)
0.0
Closure
(%)
24.5
Bending Residues
( green )
  51 - 54
  325 - 326
  391 - 392
  394 - 395
Bending Region Analysis
Property Value
Fixed Domain
( blue )
1
Moving Domain
( yellow )
3
Rotation Angle
(deg)
5.1
Translation
(A)
0.1
Closure
(%)
91.1
Bending Residues
( green )
  95 - 98
  249 - 252
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download