Atp-Dependent Metalloprotease Ftsh

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Atp-Dependent Metalloprotease Ftsh
  Conformer 1
(PDB)
1iy2 (A)
  Conformer 2
(PDB)
1ixz (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 165 1.17   150 - 323
2 69 0.71   324 - 392

Sequence


           ________________________________________________________________________________________________________________________ 
 1iy2(A) : SRARVLTEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVG 
         :                                                                                                                          
 1ixz(A) : ******TEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVG 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________________323__________________________________________________________________ 
 1iy2(A) : RKnDEREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRKITMKDL 
         :                                                                                                                          
 1ixz(A) : R-nDEREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRKITMKDL 
           ___________________________________________________323__________________________________________________________________ 

           _____                                                                                                                    
 1iy2(A) : EEAAS                                                                                                                    
         :                                                                                                                          
 1ixz(A) : EEAAS                                                                                                                    
           _____                                                                                                                    

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
29.8
Translation
(A)
0.7
Closure
(%)
18.4
Bending Residues
( green )
  323 - 324
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download