Cell Division Cycle 42 Isoform 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cell Division Cycle 42 Isoform 1
  Conformer 1
(PDB)
2dfk (B)
  Conformer 2
(PDB)
1nf3 (B)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 147 1.01   5 - 23   54 - 54   56 - 186
2 31 2.56   24 - 53   55 - 55

Sequence


           _________________________23____________________________53_______________________________________________________________ 
 2dfk(B) : ****MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQ 
         :                                                                                                                          
 1nf3(B) : GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQ 
           _________________________23____________________________53_______________________________________________________________ 

           ___________________________________________________________________________                                              
 2dfk(B) : IDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP----kSRRCVLL                                              
         :                                                                                                                          
 1nf3(B) : IDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL*                                              
           ___________________________________________________________________________                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
17.9
Translation
(A)
-0.5
Closure
(%)
53.1
Bending Residues
( green )
  23 - 24
  53 - 56
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download