Citrate Synthase (E.C.4.1.3.7)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Citrate Synthase (E.C.4.1.3.7)
  Conformer 1
(PDB)
6cts  
  Conformer 2
(PDB)
5csc (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 325 0.9   5 - 56   65 - 274   278 - 282   330 - 336   341 - 341   381 - 431
2 98 1.26   57 - 64   275 - 277   283 - 329   337 - 340   342 - 380

Sequence


           ______________________________________________________56______64________________________________________________________ 
 6cts    : ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKGGgGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAALP 
         :                                                                                                                          
 5csc(A) : ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKALPKGGgGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAALP 
           ______________________________________________________56______64________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 6cts    : SHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEGG 
         :                                                                                                                          
 5csc(A) : SHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEGG 
           ________________________________________________________________________________________________________________________ 

           _____________________________273_____281__________________________________________329____336_340________________________ 
 6cts    : NVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAaGADASLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQ 
         :                                                                                                                          
 5csc(A) : NVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAaGADASLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQ 
           _____________________________273_____281__________________________________________329____336_340________________________ 

           _____________380_____________________________________________________                                                    
 6cts    : GAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL                                                    
         :                                                                                                                          
 5csc(A) : GAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL                                                    
           _____________380_____________________________________________________                                                    

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
19.1
Translation
(A)
0.2
Closure
(%)
81.6
Bending Residues
( green )
  56 - 57
  64 - 65
  273 - 279
  281 - 283
  329 - 330
  336 - 337
  340 - 342
  380 - 381
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download