Citrate Synthase (E.C.4.1.3.7)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Citrate Synthase (E.C.4.1.3.7)
  Conformer 1
(PDB)
5csc (A)
  Conformer 2
(PDB)
2csc  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 330 0.92   5 - 56   65 - 274   278 - 282   329 - 336   338 - 338   341 - 341   343 - 345   381 - 431
2 93 1.26   57 - 64   275 - 277   283 - 328   337 - 337   339 - 340   342 - 342   346 - 380

Sequence


           ______________________________________________________56______64________________________________________________________ 
 5csc(A) : ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKALPKGGgGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAALP 
         :                                                                                                                          
 2csc    : ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKGGgGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAALP 
           ______________________________________________________56______64________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 5csc(A) : SHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEGG 
         :                                                                                                                          
 2csc    : SHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEGG 
           ________________________________________________________________________________________________________________________ 

           _____________________________273_____281_________________________________________328_____336____________________________ 
 5csc(A) : NVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAaGADASLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQ 
         :                                                                                                                          
 2csc    : NVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAaGADASLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQ 
           _____________________________273_____281_________________________________________328_____336____________________________ 

           _____________380_____________________________________________________                                                    
 5csc(A) : GAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL                                                    
         :                                                                                                                          
 2csc    : GAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL                                                    
           _____________380_____________________________________________________                                                    

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
19.3
Translation
(A)
0.1
Closure
(%)
85.6
Bending Residues
( green )
  56 - 57
  64 - 65
  273 - 279
  281 - 283
  328 - 329
  336 - 346
  380 - 381
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download