Citrate Synthase (E.C.4.1.3.7)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Citrate Synthase (E.C.4.1.3.7)
  Conformer 1
(PDB)
5csc (A)
  Conformer 2
(PDB)
1csr  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 320 0.9   5 - 56   65 - 274   279 - 281   333 - 336   344 - 345   382 - 431
2 103 2.24   57 - 64   275 - 278   282 - 332   337 - 343   346 - 381

Sequence


           ______________________________________________________56______64________________________________________________________ 
 5csc(A) : ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKALPKGGgGE-PLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAAL 
         :                                                                                                                          
 1csr    : **STNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPKAGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAAL 
           ______________________________________________________56______64________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 5csc(A) : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEG 
         :                                                                                                                          
 1csr    : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEG 
           ________________________________________________________________________________________________________________________ 

           ______________________________273__278___________________________________________________332_336____343_________________ 
 5csc(A) : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAaGADAS---LRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNV 
         :                                                                                                                          
 1csr    : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNV 
           ______________________________273__278___________________________________________________332_336____343_________________ 

           __________________381________________________________________________________                                            
 5csc(A) : LLEQGAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL****                                            
         :                                                                                                                          
 1csr    : LLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAGG                                            
           __________________381________________________________________________________                                            

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
18.9
Translation
(A)
0.4
Closure
(%)
86.7
Bending Residues
( green )
  56 - 57
  64 - 65
  273 - 276
  278 - 282
  332 - 334
  336 - 337
  343 - 346
  381 - 382
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download