Complement C3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Complement C3
  Conformer 1
(PDB)
2a73 (B)
  Conformer 2
(PDB)
2i07 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 437 10.58   748 - 965   1270 - 1329   1479 - 1639
2 294 4.77   966 - 1265
3 132 3.65   1336 - 1476

Sequence


           ________________________________________________________________________________________________________________________ 
 2a73(B) : VQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARAlDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITT 
         :                                                                                                                          
 2i07(B) : **********************************************************************DEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITT 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2a73(B) : WEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFI 
         :                                                                                                                          
 2i07(B) : WEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFI 
           ________________________________________________________________________________________________________________________ 

           ____________________________________________________________962_________________________________________________________ 
 2a73(B) : SDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEK 
         :                                                                                                                          
 2i07(B) : SDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEENMIGMTPTVIAVHYLDETEQWEKFGLEK 
           ____________________________________________________________962_________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2a73(B) : RQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQE------nNNEKDMALTAFVLISLQEAKDICEEQ 
         :                                                                                                                          
 2i07(B) : RQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQ 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2a73(B) : VNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQ 
         :                                                                                                                          
 2i07(B) : VNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQ 
           ________________________________________________________________________________________________________________________ 

           __1265____________________________________________________________1329__________________________________________________ 
 2a73(B) : YQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS 
         :                                                                                                                          
 2i07(B) : YQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAP---------kNTMILEICTRYRGDQDATMS 
           __1265____________________________________________________________1329__________________________________________________ 

           ___________________________________________________________________________________________1474_________________________ 
 2a73(B) : ILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQ 
         :                                                                                                                          
 2i07(B) : ILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQ 
           ___________________________________________________________________________________________1474_________________________ 

           ________________________________________________________________________________________________________________________ 
 2a73(B) : KSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEE 
         :                                                                                                                          
 2i07(B) : K--dKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEE 
           ________________________________________________________________________________________________________________________ 

           ______________________                                                                                                   
 2a73(B) : NQKQCQDLGAFTESMVVFGCPN                                                                                                   
         :                                                                                                                          
 2i07(B) : NQKQCQDLGAFTESMVVFGCPN                                                                                                   
           ______________________                                                                                                   

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
125.1
Translation
(A)
8.4
Closure
(%)
93.2
Bending Residues
( green )
  962 - 970
  1265 - 1270
Bending Region Analysis
Property Value
Fixed Domain
( blue )
1
Moving Domain
( yellow )
3
Rotation Angle
(deg)
41.2
Translation
(A)
-7.6
Closure
(%)
6.7
Bending Residues
( green )
  1329 - 1336
  1474 - 1496
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download