Cyanovirin-N

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cyanovirin-N
  Conformer 1
(PDB)
1l5b (B)
  Conformer 2
(PDB)
3ezm (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 49 0.47   3 - 51
2 48 0.76   52 - 99

Sequence


           ________________________________________________50___________________________________________________                    
 1l5b(B) : LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE                    
         :                                                                                                                          
 3ezm(A) : LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE                    
           ________________________________________________50___________________________________________________                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
72.0
Translation
(A)
0.6
Closure
(%)
99.9
Bending Residues
( green )
  50 - 55
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: null

PyMOL Script

Download and extract PyMOL PML script file Download