DNA Topoisomerase 2-Binding Protein 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name DNA Topoisomerase 2-Binding Protein 1
  Conformer 1
(PDB)
3al2 (A)
  Conformer 2
(PDB)
3al3 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 124 1.01   1268 - 1392
2 88 0.8   1393 - 1489

Sequence


           _______________________________________________________________________________________________________________________1 
 3al2(A) : KQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAA-rWRKKIQQRQ 
         :                                                                                                                          
 3al3(A) : KQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKKIQQRQ 
           _______________________________________________________________________________________________________________________1 

           388_________________________________________________________________________________________________                     
 3al2(A) : ESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATHLFSDLgVNIAEAAAQNVYCLRTEYIADYL-qESPPHVENYCLPEAISFI                     
         :                                                                                                                          
 3al3(A) : ESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATHLFSDLgVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAIS**                     
           388_________________________________________________________________________________________________                     

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
23.1
Translation
(A)
-1.0
Closure
(%)
93.7
Bending Residues
( green )
  1388 - 1393
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download