Elongation Factor 1-Alpha

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Elongation Factor 1-Alpha
  Conformer 1
(PDB)
1jny (A)
  Conformer 2
(PDB)
1f60 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 208 2.39   6 - 225   227 - 227
2 201 1.22   226 - 226   228 - 427

Sequence


           ________________________________________________________________________________________________________________________ 
 1jny(A) : ***KPHLNLIVIGHVDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRLKEE-----------mRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKG 
         :                                                                                                                          
 1f60(A) : GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVG 
           ________________________________________________________________________________________________________________________ 

           __________________________________________________________________________________________________________________225___ 
 1jny(A) : EYEAGMSVEGQTREHIILAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEIVDQVSKFMRSYGFNTNKVRFVPVVAPSGDNITHKSENMKWYNG------------PTLEEYLDQLELPPKP 
         :                                                                                                                          
 1f60(A) : EFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRP 
           __________________________________________________________________________________________________________________236___ 

           ________________________________________________________________________________________________________________________ 
 1jny(A) : VDKPLRIPIQDVYSISGVGTVPVGRVESGVLKVGDKIVFMPAGKVGEVRSIETHHTKMDKAEPGDNIGFNVRGVEKKDIKRGDVVGHP-NNPPTVADEFTARIIVVWHPTALANGYTPVL 
         :                                                                                                                          
 1f60(A) : TDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVL 
           ________________________________________________________________________________________________________________________ 

           __________________________________________________________________________________                                       
 1jny(A) : HVHTASVACRVSELVSKLDPRTGQEAEKNPQFLKQGDVAIVKFKPIKPLCVEKYNEFPPLGRFAMRDMGKTVGVGIIVDVKP                                       
         :                                                                                                                          
 1f60(A) : DCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK                                       
           __________________________________________________________________________________                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
71.1
Translation
(A)
-0.5
Closure
(%)
82.5
Bending Residues
( green )
  225 - 228
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download