425Aa Long Hypothetical Proton Glutamate Symport Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 425Aa Long Hypothetical Proton Glutamate Symport Protein
  Conformer 1
(PDB)
2nwl (A)
  Conformer 2
(PDB)
3kbc (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 230 2.61   81 - 122   227 - 414
2 168 2.8   12 - 80   128 - 226

Sequence


           ________________________________________________________________71____________________________________110_______________ 
 2nwl(A) : ****YPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQF--- 
         :                                                                                                                          
 3kbc(A) : KYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLCMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPH 
           ________________________________________________________________71____________________________________110_______________ 

           _____________________________________________________________________________________________221________________________ 
 2nwl(A) : --pPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILL 
         :                                                                                                                          
 3kbc(A) : QAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILL 
           _____________________________________________________________________________________________221________________________ 

           ________________________________________________________________________________________________________________________ 
 2nwl(A) : VYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAM 
         :                                                                                                                          
 3kbc(A) : VYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVATFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLCM 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________________                                                                      
 2nwl(A) : VLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTE                                                                      
         :                                                                                                                          
 3kbc(A) : VLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTE                                                                      
           ___________________________________________________                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
40.6
Translation
(A)
8.2
Closure
(%)
87.4
Bending Residues
( green )
  71 - 82
  110 - 128
  221 - 227
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download