Glycerate Dehydrogenase/glyoxylate Reductase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glycerate Dehydrogenase/glyoxylate Reductase
  Conformer 1
(PDB)
2cuk (C)
  Conformer 2
(PDB)
2cuk (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 187 0.35   98 - 284
2 120 0.3   3 - 97   285 - 309

Sequence


           _______________________________________________________________________________________________97_______________________ 
 2cuk(C) : MRVLVTRTLPGKALDRLRERGLEVEVHRGLFLPKAELLKRVEGAVGLIPTVEDRIDAEVMDRAKGLKVIACYSVGVDHVDLEAARERGIRVTHTPGVLTEATADLTLALLLAVARRVVEG 
         :                                                                                                                          
 2cuk(D) : MRVLVTRTLPGKALDRLRERGLEVEVHRGLFLPKAELLKRVEGAVGLIPTVEDRIDAEVMDRAKGLKVIACYSVGVDHVDLEAARERGIRVTHTPGVLTEATADLTLALLLAVARRVVEG 
           _______________________________________________________________________________________________97_______________________ 

           ________________________________________________________________________________________________________________________ 
 2cuk(C) : AAYARDGLWKAWHPELLLGLDLQGLTLGLVGMGRIGQAVAKRALAFGMRVVYHARTPKPLPYPFLSLEELLKEADVVSLHTPLTPETHRLLNRERLFAMKRGAILLNTARGALVDTEALV 
         :                                                                                                                          
 2cuk(D) : AAYARDGLWKAWHPELLLGLDLQGLTLGLVGMGRIGQAVAKRALAFGMRVVYHARTPKPLPYPFLSLEELLKEADVVSLHTPLTPETHRLLNRERLFAMKRGAILLNTARGALVDTEALV 
           ________________________________________________________________________________________________________________________ 

           ________________________________________283____________________________                                                  
 2cuk(C) : EALRGHLFGAGLDVTDPEPLPPGHPLYALPNAVITPHIGSAGRTTRERMAEVAVENLLAVLEGREPPNPVV                                                  
         :                                                                                                                          
 2cuk(D) : EALRGHLFGAGLDVTDPEPLPPGHPLYALPNAVITPHIGSAGRTTRERMAEVAVENLLAVLEGREPPNPVV                                                  
           ________________________________________283____________________________                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
10.7
Translation
(A)
-0.1
Closure
(%)
100.0
Bending Residues
( green )
  97 - 98
  283 - 286
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download