3-Phytase A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 3-Phytase A
  Conformer 1
(PDB)
1ska (A)
  Conformer 2
(PDB)
1sk9 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 266 0.44   37 - 39   45 - 48   51 - 56   114 - 209   274 - 362   365 - 374   382 - 416   418 - 441
2 165 0.44   10 - 36   40 - 44   49 - 50   57 - 113   210 - 273   363 - 364   375 - 381   417 - 417

Sequence


           ___________________________36_39___44__48______56______________________________________________________113______________ 
 1ska(A) : CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKAL 
         :                                                                                                                          
 1sk9(A) : CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKAL 
           ___________________________36_39___44__48______56______________________________________________________113______________ 

           ______________________________________________________________________________209_______________________________________ 
 1ska(A) : ARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVAR 
         :                                                                                                                          
 1sk9(A) : ARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVAR 
           ______________________________________________________________________________209_______________________________________ 

           ______________________273__________________________________________________________________________________358__________ 
 1ska(A) : TSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKE 
         :                                                                                                                          
 1sk9(A) : TSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKE 
           ______________________273__________________________________________________________________________________358__________ 

           ___374____381____________________________412_______________________________                                              
 1ska(A) : LDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF                                              
         :                                                                                                                          
 1sk9(A) : LDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF                                              
           ___374____381____________________________412_______________________________                                              

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
3.9
Translation
(A)
-0.1
Closure
(%)
82.3
Bending Residues
( green )
  36 - 37
  39 - 40
  44 - 45
  48 - 51
  56 - 57
  113 - 114
  209 - 210
  273 - 274
  358 - 365
  374 - 375
  381 - 382
  412 - 418
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download