At-Rich Dna-Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name At-Rich Dna-Binding Protein
  Conformer 1
(PDB)
1xcb (A)
  Conformer 2
(PDB)
2dt5 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 126 0.66   78 - 204
2 71 1.24   7 - 77

Sequence


           ___________________________________________________________________________77___________________________________________ 
 1xcb(A) : *KVPEAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGVGYTVPVLKRELRHILGLNRKWGLCIVG-gRLGSALADYPGFGESFELRGFFDVDPEKVGR 
         :                                                                                                                          
 2dt5(B) : MKVPEAAISRLITYLRILEELEAQGVHRTSSEQLGGLAQVTAFQVRKDLSYFGSYGTRGVGYTVPVLKRELRHILGLNRKWGLCIVGMGRLGSALADYPGFGESFELRGFFDVDPEKVGR 
           ___________________________________________________________________________77___________________________________________ 

           ___________________________________________________________________________________________                              
 1xcb(A) : PVRGGVIEHVDLLPQRVPGRIEIALLTVPREAAQKAADLLVAAGIKGILNFAPVVLEVPKEVAVENVDFLAGLTRLSFAILNPKWR*****                              
         :                                                                                                                          
 2dt5(B) : PVRGGVIEHVDLLPQRVPGRIEIALLTVPREAAQKAADLLVAAGIKGILNFAPVVLEVPKEVAVENVDFLAGLTRLSFAILNPKWREEMMG                              
           ___________________________________________________________________________________________                              

Morph

This morph was created using the MorphIt_Pro protein