2-C-methyl-D-erythritol 2,4-cyclodiphosphate
Ligand-induced domain movement details

Jmol view of liganded conformation 1

Domain Movement

domain 1 is binding domain(fixed in space)	domain 2 is binding domain(fixed in space)

Sequence

__________________________________________________   1h48(E) : *EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDAL           :                                                      1h47(E) : LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDAL             __________________________________________________             __52_____________________75_______________________   1h48(E) : LGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTI           :                                                      1h47(E) : LGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTI             __52_____________________75_______________________             __________________________________________________   1h48(E) : IAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIAC           :                                                      1h47(E) : IAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIAC             __________________________________________________             ________                                             1h48(E) : EAVALLIK                                                     :                                                      1h47(E) : EAVALLIK                                                       ________

Details

Property   Value  Conformer 1 1h48(E)  Conformer 2 1h47(E)  Radius gyration for conformer 1 15.16 A  Radius gyration for conformer 2 15.16 A  EC Number 4.6.1.12   Click here to see the DynDom results or the famliy  Trigger ligands C5P901 CDI421  Trigger ligands in which conformation Conformation  1  Conformaton with trigger ligands is compact No  Spanning ligands Yes  Residues in enzyme contacting ligands ALA33  ASP56  ASP63  ASP8  GLY58  HIS10  HIS34  HIS42  ILE57  LEU76  LYS59  PHE61  PRO62  SER35   Residues in extended bending regions contacting ligands ASP56  GLY58  ILE57  LEU76  LYS59   Residues in extended bending regions making H-bonds or salt-bridges with ligands ASP56  ILE57    Residues in extended bending regions with an H-bond between its main chain and ligands ILE57  Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT