Guanylate kinase
Ligand-induced domain movement details

Jmol view of liganded conformation 2

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           _____________________________32___________________ 
 2f3t(C) : AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHG 
         :                                                    
 2f3t(F) : AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHG 
           _____________________________32___________________ 

           _________________________________86_______________ 
 2f3t(C) : EHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFL 
         :                                                    
 2f3t(F) : EHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFL 
           _________________________________86_______________ 

           __________________________________________________ 
 2f3t(C) : DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLR----dSEEVIAKRMA 
         :                                                    
 2f3t(F) : DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMA 
           __________________________________________________ 

           __________________________________________________ 
 2f3t(C) : QAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI 
         :                                                    
 2f3t(F) : QAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALI 
           __________________________________________________ 

           _____                                              
 2f3t(C) : SKLLA                                              
         :                                                    
 2f3t(F) : SKLLA                                              
           _____                                              

Details

  Property   Value
 Conformer 1 2f3t(C)
 Conformer 2 2f3t(F)
 Radius gyration for conformer 1 18.95 A
 Radius gyration for conformer 2 18.79 A
 EC Number 2.7.4.8  
Click here to see the DynDom results or the famliy
 Trigger ligands LGP303
 Trigger ligands in which conformation Conformation  2
 Conformaton with trigger ligands is compact Yes
 Spanning ligands No
 Residues in enzyme contacting ligands ALA75  ARG45  GLU73  SER38  TYR54  TYR82 
 Residues in extended bending regions contacting ligands SER38 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands SER38 
  Residues in extended bending regions with an H-bond between its main chain and ligands Null
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT