Adenylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adenylate Kinase
  Conformer 1
(PDB) 		4ake (A)
  Conformer 2
(PDB) 		1ake (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 117 1.45   3 - 28   79 - 116   160 - 212
2 21 0.54   29 - 31   61 - 78
3 43 0.59   117 - 159
4 29 1.63   32 - 60

Sequence


           __________________________28_31___________________________60________________78___________________________________116____ 
 4ake(A) : MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRI 
         :                                                                                                                          
 1ake(A) : MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRI 
           __________________________28_31___________________________60________________78___________________________________116____ 

           __________________________________157_________________________________________________________                           
 4ake(A) : VGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG                           
         :                                                                                                                          
 1ake(A) : VGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG                           
           __________________________________157_________________________________________________________                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 20.3 -0.8 71.8   28 - 29   78 - 80 Bending Region Analysis
1 3 50.8 0.3 99.6   116 - 119   157 - 163 Bending Region Analysis
4 2 32.9 0.7 99.8   31 - 32   60 - 61 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download