50S Ribosomal Protein L22

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 50S Ribosomal Protein L22
  Conformer 1
(PDB) 		1vs9 (Q)
  Conformer 2
(PDB) 		1i4j (B)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 71 1.71   9 - 77   99 - 99   103 - 103
2 21 6.31   78 - 98   100 - 102

Sequence


           __________________________________________________________________________76____________________98_______________        
 1vs9(Q) : *EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEK***        
         :                                                                                                                          
 1i4j(B) : MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDALEDRLYVKAAYVDEGPA---VLPRARGRADIIKKRTSHITVILGEKHGK        
           __________________________________________________________________________76____________________98_______________        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		62.4
Translation
(A) 		2.8
Closure
(%) 		20.8
Bending Residues
( green ) 		  76 - 78
  98 - 103
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download