Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1qx5 (J)
  Conformer 2
(PDB) 		1qx7 (R)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 96 0.71   33 - 56   64 - 142
2 34 0.99   6 - 32   57 - 63

Sequence


           _____________________________32____________________54_______63__________________________________________________________ 
 1qx5(J) : *QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV 
         :                                                                                                                          
 1qx7(R) : DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTV-rSLGQNPTEAELQD-iNEVDADGNGTIDFPEFLT--aRK-kDTDSEEEIREAFRVFDKDGNGYISAAELRHV-tNLGEKLTDEEV 
           _____________________________32____________________54_______63__________________________________________________________ 

           _________________________                                                                                                
 1qx5(J) : DEMIREADIDGDGQVNYEEFVQMMT                                                                                                
         :                                                                                                                          
 1qx7(R) : DE-iREADIDGDGQVNYEEFVQt**                                                                                                
           _________________________                                                                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.7
Translation
(A) 		0.3
Closure
(%) 		51.8
Bending Residues
( green ) 		  32 - 33
  54 - 57
  63 - 64
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download