Carboxy Terminus Of Hsp70-Interacting Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Carboxy Terminus Of Hsp70-Interacting Protein
  Conformer 1
(PDB) 		2c2l (A)
  Conformer 2
(PDB) 		2c2l (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 135 0.97   26 - 156   221 - 224
2 58 1.01   162 - 219
3 78 1.13   225 - 302

Sequence


           ________________________________________________________________________________________________________________________ 
 2c2l(A) : SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIA 
         :                                                                                                                          
 2c2l(B) : SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIA 
           ________________________________________________________________________________________________________________________ 

           ________154_____________________________________________________________218_____________________________________________ 
 2c2l(A) : KKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQ 
         :                                                                                                                          
 2c2l(B) : KKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQ 
           ________154_____________________________________________________________218_____________________________________________ 

           _________________________________________                                                                                
 2c2l(A) : RVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY                                                                                
         :                                                                                                                          
 2c2l(B) : RVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY                                                                                
           _________________________________________                                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		115.8
Translation
(A) 		-3.8
Closure
(%) 		77.9
Bending Residues
( green ) 		  154 - 162
  218 - 224
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		107.4
Translation
(A) 		-0.4
Closure
(%) 		93.6
Bending Residues
( green ) 		  221 - 228
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download