2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase
  Conformer 1
(PDB) 		1h48 (E)
  Conformer 2
(PDB) 		1h47 (E)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 123 0.28   7 - 56   77 - 149
2 20 0.96   57 - 76

Sequence


           ____________________________________________________52_____________________75___________________________________________ 
 1h48(E) : *EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAE 
         :                                                                                                                          
 1h47(E) : LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAE 
           ____________________________________________________52_____________________75___________________________________________ 

           ______________________________________                                                                                   
 1h48(E) : DLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK                                                                                   
         :                                                                                                                          
 1h47(E) : DLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK                                                                                   
           ______________________________________                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.8
Translation
(A) 		-0.2
Closure
(%) 		95.4
Bending Residues
( green ) 		  52 - 57
  75 - 78
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download