General Stress Protein Ctc

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name General Stress Protein Ctc
  Conformer 1
(PDB) 		1vow (W)
  Conformer 2
(PDB) 		1vou (W)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 87 1.17   4 - 90
2 80 0.0   91 - 170

Sequence


           ____________________________________________________________________________________86__________________________________ 
 1vow(W) : MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYgePVEVSVPVHTTGRSQGEVQGGLVDIVVHNL 
         :                                                                                                                          
 1vou(W) : MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGePVEVSVPVHTTGRSQGEVQGGLVDIVVHNL 
           ____________________________________________________________________________________86__________________________________ 

           _____________________________________________________                                                                    
 1vow(W) : QIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLP                                                                    
         :                                                                                                                          
 1vou(W) : QIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLP                                                                    
           _____________________________________________________                                                                    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.2
Translation
(A) 		1.5
Closure
(%) 		90.4
Bending Residues
( green ) 		  86 - 92
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download