Glutathione S-Transferase Mu 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutathione S-Transferase Mu 2
  Conformer 1
(PDB) 		1xw5 (B)
  Conformer 2
(PDB) 		1hnb (A)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 184 0.77   7 - 30   44 - 203
2 20 2.12   31 - 43   204 - 210

Sequence


           ____________________________30___________43_____________________________________________________________________________ 
 1xw5(B) : PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFE 
         :                                                                                                                          
 1hnb(A) : PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFE 
           ____________________________30___________43_____________________________________________________________________________ 

           __________________________________________________________________________197____________________                        
 1xw5(B) : KLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK                        
         :                                                                                                                          
 1hnb(A) : KLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK                        
           __________________________________________________________________________197____________________                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		24.6
Translation
(A) 		0.4
Closure
(%) 		41.2
Bending Residues
( green ) 		  30 - 31
  43 - 48
  197 - 206
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download