Heat Shock Protein 40

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Heat Shock Protein 40
  Conformer 1
(PDB) 		1c3g (A)
  Conformer 2
(PDB) 		2b26 (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 93 0.94   186 - 271   295 - 296   310 - 327
2 54 0.78   272 - 294   297 - 309   328 - 345

Sequence


           ________________________________________________________________________________________270_____________________294_____ 
 1c3g(A) : ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSR 
         :                                                                                                                          
 2b26(A) : ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKIT-------------rKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSR 
           ________________________________________________________________________________________270_____________________294_____ 

           _____307_______________325________________________                                                                       
 1c3g(A) : VQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID                                                                       
         :                                                                                                                          
 2b26(A) : VQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID                                                                       
           _____307_______________325________________________                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.4
Translation
(A) 		0.0
Closure
(%) 		33.2
Bending Residues
( green ) 		  270 - 272
  294 - 297
  307 - 310
  325 - 331
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download