Hypothetical Upf0134 Protein Mpn010

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hypothetical Upf0134 Protein Mpn010
  Conformer 1
(PDB) 		2ba2 (B)
  Conformer 2
(PDB) 		2ba2 (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 22 0.33   139 - 160
2 25 0.68   108 - 132
3 22 0.26   161 - 182

Sequence


           _________________________132_________________________160_________________________                                        
 2ba2(B) : *TRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGKTLQLILEALQGINKRLDNLES                                        
         :                                                                                                                          
 2ba2(C) : GTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGKTLQLILEALQGINKRLDNLES                                        
           _________________________232_________________________260_________________________                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		14.5
Translation
(A) 		-1.4
Closure
(%) 		93.2
Bending Residues
( green ) 		  132 - 142
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		10.2
Translation
(A) 		-0.1
Closure
(%) 		5.8
Bending Residues
( green ) 		  160 - 161
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download