Ig Gamma-2a Chain C Region

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ig Gamma-2a Chain C Region
  Conformer 1
(PDB) 		1i1a (D)
  Conformer 2
(PDB) 		1i1c (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 168 1.47   241 - 265   275 - 287   290 - 292   305 - 323   334 - 441
2 33 2.23   266 - 274   288 - 289   293 - 304   324 - 333

Sequence


           ________________________265______274__________287__292_________304________________323_______333_________________________ 
 1i1a(D) : SVFIFPPKTKDVLGGGLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVERDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEM 
         :                                                                                                                          
 1i1c(A) : SVFIFPPKTKDVLGGGLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVERDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEM 
           ________________________265______274__________287__292_________304________________323_______333_________________________ 

           _____________________________________________________________________________________                                    
 1i1a(D) : TQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLENEHTEKSLSH                                    
         :                                                                                                                          
 1i1c(A) : TQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLENEHTEKSLSH                                    
           _____________________________________________________________________________________                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.9
Translation
(A) 		0.4
Closure
(%) 		60.9
Bending Residues
( green ) 		  265 - 266
  274 - 275
  287 - 290
  292 - 293
  304 - 306
  323 - 324
  333 - 335
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download