Light Chain Of E16 Antibody

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Light Chain Of E16 Antibody
  Conformer 1
(PDB) 		1ztx (L)
  Conformer 2
(PDB) 		1cic (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 105 0.75   106 - 210
2 103 0.64   3 - 105

Sequence


           ______________________________________________________________________________________________________105_______________ 
 1ztx(L) : DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLISWASTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLALYYCQQHYTTPLTFGAGTKLELKRADAAPTVSIFPP 
         :                                                                                                                          
 1cic(A) : DIVMTQSHKFMSTSVGDRVSITCKASQDVRIAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQHCGSYPFTFGSGTKLEIKRADAAPTVSIFPP 
           ______________________________________________________________________________________________________105_______________ 

           ______________________________________________________________________________________________                           
 1ztx(L) : SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN**                           
         :                                                                                                                          
 1cic(A) : SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC                           
           ______________________________________________________________________________________________                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		24.9
Translation
(A) 		-1.2
Closure
(%) 		95.1
Bending Residues
( green ) 		  105 - 107
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download