Mast/stem Cell Growth Factor Receptor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mast/stem Cell Growth Factor Receptor
  Conformer 1
(PDB) 		2o26 (U)
  Conformer 2
(PDB) 		2o26 (Y)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 92 0.15   112 - 119   124 - 207
2 77 0.08   39 - 111   120 - 123
3 101 0.1   208 - 308

Sequence


           _________________________________________________________________________111_____119____________________________________ 
 2o26(U) : PPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSQYSLIECDGK 
         :                                                                                                                          
 2o26(Y) : PPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSQYSLIECDGK 
           _________________________________________________________________________111_____119____________________________________ 

           ________________________________________________206_____________________________________________________________________ 
 2o26(U) : SLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVREAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQ 
         :                                                                                                                          
 2o26(Y) : SLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVREAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQ 
           ________________________________________________206_____________________________________________________________________ 

           ___________________________________                                                                                      
 2o26(U) : ETLTISSARVDDSGVFMCYANNTFGSANVTTTLKV                                                                                      
         :                                                                                                                          
 2o26(Y) : ETLTISSARVDDSGVFMCYANNTFGSANVTTTLKV                                                                                      
           ___________________________________                                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		1.7
Translation
(A) 		0.0
Closure
(%) 		67.1
Bending Residues
( green ) 		  111 - 112
  119 - 127
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		6.9
Translation
(A) 		0.0
Closure
(%) 		95.0
Bending Residues
( green ) 		  206 - 213
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download