Metalloproteinase-2 Inhibitor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Metalloproteinase-2 Inhibitor
  Conformer 1
(PDB) 		1br9  
  Conformer 2
(PDB) 		1bqq (T)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 117 2.09   7 - 123
2 53 1.98   124 - 176

Sequence


           ________________________________________________________________________________________________________________________ 
 1br9    : CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNH 
         :                                                                                                                          
 1bqq(T) : CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNH 
           _______________________________________________________________________________________________________________________1 

           123_____________________________________________________________                                                         
 1br9    : RYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAA**                                                         
         :                                                                                                                          
 1bqq(T) : RYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP                                                         
           123_____________________________________________________________                                                         

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		22.3
Translation
(A) 		-0.2
Closure
(%) 		72.0
Bending Residues
( green ) 		  123 - 125
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download