Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5k8q (A)
  Conformer 2
(PDB) 		1cll (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 32 0.77   6 - 15   17 - 25   63 - 75
2 38 0.43   16 - 16   26 - 62
3 65 0.79   81 - 145

Sequence


           ____________15________25___________________________________62___________75______________________________________________ 
 5k8q(A) : DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK---sEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV 
         :                                                                                                                          
 1cll(A) : **LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV 
           ____________15________25___________________________________62___________75______________________________________________ 

           __________________________                                                                                               
 5k8q(A) : DEMIREADIDGDGQVNYEEFVQMMTA                                                                                               
         :                                                                                                                          
 1cll(A) : DEMIREADIDGDGQVNYEEFVQMMTA                                                                                               
           __________________________                                                                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.1
Translation
(A) 		0.1
Closure
(%) 		61.4
Bending Residues
( green ) 		  15 - 17
  25 - 26
  62 - 63
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		166.2
Translation
(A) 		-6.4
Closure
(%) 		83.2
Bending Residues
( green ) 		  75 - 82
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download