Bisphosphoglycerate mutase
Ligand-induced domain movement details

Jmol view of liganded conformation 2

Domain Movement

domain 1 is binding domain(fixed in space)	domain 2 is binding domain(fixed in space)

Sequence

_______10_________________________________________   1t8p(B) : SKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFE           :                                                      2hhj(B) : SKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFE             _______10_________________________________________             _____________________________________________98___   1t8p(B) : FDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNRE           :                                                      2hhj(B) : FDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNRE             _____________________________________________98___             _________________121______________________________   1t8p(B) : QMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQ           :                                                      2hhj(B) : QMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQ             _________________121______________________________             __________________________________________________   1t8p(B) : LPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEG           :                                                      2hhj(B) : LPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEG             __________________________________________________             __________________________________________________   1t8p(B) : ISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVED*           :                                                      2hhj(B) : ISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQ             __________________________________________________             ____                                                 1t8p(B) : ****                                                         :                                                      2hhj(B) : GKVK                                                           ____

Details

Property   Value  Conformer 1 1t8p(B)  Conformer 2 2hhj(B)  Radius gyration for conformer 1 17.62 A  Radius gyration for conformer 2 17.43 A  EC Number 5.4.2.4   5.4.2.1   3.1.3.13   Click here to see the DynDom results or the famliy  Trigger ligands 3PG3201 PHS1013 DG22200  Trigger ligands in which conformation Conformation  2  Conformaton with trigger ligands is compact Yes  Spanning ligands Yes  Residues in enzyme contacting ligands ARG10  ARG100  ARG116  ARG117  ARG62  ASN17  ASN190  CYS23  GLU89  GLY189  HIS11  HIS188  PHE22  SER24  TYR92   Residues in extended bending regions contacting ligands ARG10  ARG100  ASN17  CYS23  HIS11  PHE22  SER24   Residues in extended bending regions making H-bonds or salt-bridges with ligands ARG10  ARG100  ASN17  CYS23  HIS11  SER24    Residues in extended bending regions with an H-bond between its main chain and ligands CYS23  SER24  Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT