HYPOXANTHINE GUANINE PHOSPHORIBOSYL-TRANSFERA
Ligand-induced domain movement details

Jmol view of liganded conformation 1

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           __________________________________________________ 
 1bzy(C) : SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVM 
         :                                                    
 1z7g(C) : SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVM 
           __________________________________________________ 

           ______61___________74_____________________________ 
 1bzy(C) : KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKS 
         :                                                    
 1z7g(C) : KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLK- 
           ______61___________74_____________________________ 

           __________________________________________________ 
 1bzy(C) : YCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYN 
         :                                                    
 1z7g(C) : ---------iKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYN 
           __________________________________________________ 

           ______________________178_________________________ 
 1bzy(C) : PKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNH 
         :                                                    
 1z7g(C) : PKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNH 
           ______________________178_________________________ 

           ______________                                     
 1bzy(C) : VCVISETGKAKYKA                                     
         :                                                    
 1z7g(C) : VCVISETGKAKYKA                                     
           ______________                                     

Details

  Property   Value
 Conformer 1 1bzy(C)
 Conformer 2 1z7g(C)
 Radius gyration for conformer 1 17.28 A
 Radius gyration for conformer 2 17.78 A
 EC Number 2.4.2.8  
Click here to see the DynDom results or the famliy
 Trigger ligands IMU300
POP400
 Trigger ligands in which conformation Conformation  1
 Conformaton with trigger ligands is compact Yes
 Spanning ligands Yes
 Residues in enzyme contacting ligands ARG199  ASP134  ASP137  ASP193  GLU133  GLY139  GLY69  ILE135  LEU101  LEU192  LEU67  LYS102  LYS140  LYS165  LYS185  LYS68  PHE186  SER103  THR138  THR141  TYR104  VAL187 
 Residues in extended bending regions contacting ligands LEU101  LYS102  SER103  TYR104 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands LEU101  LYS102  SER103  TYR104 
  Residues in extended bending regions with an H-bond between its main chain and ligands LEU101  SER103  TYR104 
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT