Adenylate Kinase Isoenzyme-2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adenylate Kinase Isoenzyme-2
  Conformer 1
(PDB) 		2ak2  
  Conformer 2
(PDB) 		4ake (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 145 2.41   21 - 139   180 - 209
2 40 1.53   140 - 179

Sequence


           ________________________________________________________________________________________________________________________ 
 2ak2    : PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPD 
         :                                                                                                                          
 4ake(A) : ***MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQA----DAMKEAGINVDYVLEFDVPD 
           ________________________________________________________________________________________________________________________ 

           ___139_______________________________173_____________________________________________________________                    
 2ak2    : SLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS*                    
         :                                                                                                                          
 4ake(A) : ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG                    
           ___119_______________________________153_____________________________________________________________                    

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.9
Translation
(A) 		-0.5
Closure
(%) 		49.7
Bending Residues
( green ) 		  205 - 206
  216 - 235
  260 - 268
  294 - 296
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download