Cystatin B

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cystatin B
  Conformer 1
(PDB) 		2oct (A)
  Conformer 2
(PDB) 		4n6v (1)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 46 5.67   10 - 50   73 - 77
2 41 1.46   51 - 72   78 - 96

Sequence


           _____________________________________________48______________________72__________________________                        
 2oct(A) : MSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF                        
         :                                                                                                                          
 4n6v(1) : ******ATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF                        
           _____________________________________________48______________________72__________________________                        

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		154.0
Translation
(A) 		-4.6
Closure
(%) 		100.0
Bending Residues
( green ) 		  48 - 51
  72 - 81
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download