Sdea

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sdea
  Conformer 1
(PDB) 		5crb (A)
  Conformer 2
(PDB) 		5crc (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 106 2.71   14 - 125
2 35 1.14   126 - 161

Sequence


           ____________________________________________________________________________________________________________119_________ 
 5crb(A) : PKYVEGVELTQEGMHAIFARMGYGDITSGSIYNGVPTIDTGALNRQGFMPVLTGVGPHRDSGHWIMLIKGPGNQYYLFDPLGKTSGEGYQNILAAQLPMGSTLSVIPNGSGLNMGLCGYW 
         :                                                                                                                          
 5crc(A) : ***VEGVELTQEG-hAIFAR-gYGDITSGSIYNGVPTIDTGALNRQGF-pVLTGVGPHRDSGHWI-lIKGPGNQYYLFDPLGKTSGEGYQNILAAQLP-gSTLSVIPNGSGLN-gLCGYW 
           ____________________________________________________________________________________________________________112_________ 

           ________________________________________________________________________                                                 
 5crb(A) : VASAGLRAHQALNQHNPPTLLNVGQTITNEMRNELDHDGYRKITGWLRAVADEFPEGDPQLDGKALRENTEK                                                 
         :                                                                                                                          
 5crc(A) : VASAGLRAHQALNQHNPPTLLNVGQTITNE-rNEL*************************************                                                 
           ________________________________________________________________________                                                 

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		177.6
Translation
(A) 		0.8
Closure
(%) 		37.3
Bending Residues
( green ) 		  119 - 126
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download