82D6a3 Igg

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 82D6a3 Igg
  Conformer 1
(PDB) 		2adf (H)
  Conformer 2
(PDB) 		2brr (H)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 119 0.89   4 - 122
2 94 1.2   123 - 216

Sequence


           ________________________________________________________________________________________________________________________ 
 2adf(H) : QIQLVQSGPELKKPGETVKISCKASGYTFINYGMNWVKQAPGKGLKWMGWKNTNTGETTYGEEFRGRFAFSLETSVSTAYLQINNLKNEDTATYFCARDN-----PYYALDYWGQGTTVT 
         :                                                                                                                          
 2brr(H) : *VQLEQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKERFAFSLETSASAAYLQINNLKNEDTATYFCARDYYGSTYPYYAMDYWGQGTTVT 
           ________________________________________________________________________________________________________________________ 

           ____122__________________________________________________________________________________________________                
 2adf(H) : VSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR**                
         :                                                                                                                          
 2brr(H) : VSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGG                
           ____117__________________________________________________________________________________________________                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.6
Translation
(A) 		-0.2
Closure
(%) 		96.1
Bending Residues
( green ) 		  122 - 123
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download