Allophycocyanin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Allophycocyanin
  Conformer 1
(PDB) 		1kn1 (B)
  Conformer 2
(PDB) 		1b33 (M)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 53 0.42   28 - 29   32 - 46   93 - 107   141 - 171
2 27 0.32   3 - 27   30 - 31
3 76 0.42   47 - 92   108 - 140   172 - 172

Sequence


           _________________________27______________43____________________________________________92____________107________________ 
 1kn1(B) : MQDAITSVINSSDVQGKYLDSSAIEKLKGYFQTGELRVRAATTIAANAANIIKEAVAKSLLYSDITRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLG 
         :                                                                                                                          
 1b33(M) : MQDAITAVINSSDVQGKYLDTAALEKLKSYFSTGELRVRAATTIAANAAAIVKEAVAKSLLYSDITRPGG-mYTTRRYAACIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLG 
           _________________________27______________43____________________________________________89____________104________________ 

           _____________139___________________171___                                                                                
 1kn1(B) : VPIGATIQAIQAMKEVTSGLVGPDAGKEMGLYFDYICSGLS                                                                                
         :                                                                                                                          
 1b33(M) : VPISATVQAIQAMKEVTASLVGPDAGKEMGVYFDYICSGLS                                                                                
           _____________136___________________158___                                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.6
Translation
(A) 		0.0
Closure
(%) 		98.2
Bending Residues
( green ) 		  27 - 32
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		6.5
Translation
(A) 		0.0
Closure
(%) 		90.4
Bending Residues
( green ) 		  43 - 47
  92 - 93
  107 - 108
  139 - 141
  171 - 172
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download