Alpha-Lytic Protease

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Alpha-Lytic Protease
  Conformer 1
(PDB) 		3pro (D)
  Conformer 2
(PDB) 		2pro (C)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 57 0.65   87 - 155
2 55 0.94   32 - 86

Sequence


           __________________________________________________________________________________86____________________________________ 
 3pro(D) : QVDPQLKFAMQRDLGIFPTQLPQYLQTEKLARTQAAAIEREFGAQFAGSWIERNEDGSFKLVAATSGARKSSTLGGVEVRNVRYSLKQLQSAMEQLDAGANlDGVQSWYVDPRSNAVVVK 
         :                                                                                                                          
 2pro(C) : ***************IFPTQLPQYLQTEKLARTQAAAIEREFGAQFAGSWIERNEDGSFKLVAATSGARKSSTLGGVEVRNVRYSLKQLQSAMEQLDAGA---gVQSWYVDPRSNAVVVK 
           __________________________________________________________________________________86____________________________________ 

           ________________________________                                                                                         
 3pro(D) : VDDGATDAGVDFVALSGADSAQVRIESSPGKL                                                                                         
         :                                                                                                                          
 2pro(C) : VDDGATDAGVDFVALSGADSAQVRIES*****                                                                                         
           ________________________________                                                                                         

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.4
Translation
(A) 		-0.4
Closure
(%) 		95.4
Bending Residues
( green ) 		  125 - 127
  133 - 135
  320 - 329
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download