Complement Decay-Accelerating Factor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Complement Decay-Accelerating Factor
  Conformer 1
(PDB)
1ok3 (B)
  Conformer 2
(PDB)
1ok3 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 60 0.25   129 - 188
2 65 0.22   64 - 128
3 63 0.45   189 - 252
4 60 0.23   4 - 63

Sequence


           ____________________________________________________________63__________________________________________________________ 
 1ok3(B) : QDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWST 
         :                                                                                                                          
 1ok3(A) : QDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWST 
           ____________________________________________________________63__________________________________________________________ 

           ____128______________________________________________________185________________________________________________________ 
 1ok3(B) : AVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTiGEHSIYCTVNNDEG 
         :                                                                                                                          
 1ok3(A) : AVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTiGEHSIYCTVNNDEG 
           ____128______________________________________________________185________________________________________________________ 

           ____________                                                                                                             
 1ok3(B) : EWSGPPPECRGC                                                                                                             
         :                                                                                                                          
 1ok3(A) : EWSGPPPECRGC                                                                                                             
           ____________                                                                                                             

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 11.2 0.2 69.5   128 - 129 Bending Region Analysis
1 3 11.7 0.2 1.4   185 - 189 Bending Region Analysis
4 2 9.2 -0.2 82.9   63 - 66 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 4 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 4

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download