Huzaf Antibody Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Huzaf Antibody Heavy Chain
  Conformer 1
(PDB) 		1t3f (B)
  Conformer 2
(PDB) 		1t04 (B)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 59 0.83   94 - 124   144 - 144   184 - 209   212 - 212
2 85 0.29   9 - 93
3 47 0.36   125 - 130   145 - 183   210 - 211

Sequence


           _________________________________________________________________________________________92_____________________________ 
 1t3f(B) : VQLVQSGAELKKPGSSVKVSCKASGYIFTSSWINWVKQAPGQGLEWIGRIDPSDGEVHYNQDFKDKATLTVDKSTNTAYMELSSLRSEDTAVYYCARGFLPWFADWGQGTLVTVSSASTK 
         :                                                                                                                          
 1t04(B) : VQLVQSGAELKKPGSSVKVSCKASGYIFTSSWINWVKQAPGQGLEWIGRIDPSDGEVHYNQDFKDKATLTVDKSTNTAYMELSSLRSEDTAVYYCARGFLPWFADWGQGTLVTVSSASTK 
           _________________________________________________________________________________________92_____________________________ 

           124________________________________________________________183_____________________207_____________                      
 1t3f(B) : GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC                      
         :                                                                                                                          
 1t04(B) : GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS*                      
           124________________________________________________________183_____________________207_____________                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.9
Translation
(A) 		-0.4
Closure
(%) 		80.1
Bending Residues
( green ) 		  92 - 94
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		6.1
Translation
(A) 		0.2
Closure
(%) 		83.0
Bending Residues
( green ) 		  124 - 145
  183 - 188
  207 - 212
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download