50S Ribosomal Protein L15

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 50S Ribosomal Protein L15
  Conformer 1
(PDB) 		2hgu (O)
  Conformer 2
(PDB) 		1vs9 (J)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 67 3.13   75 - 141
2 20 6.61   17 - 36

Sequence


           __________________________________36____________________________________________________________________________________ 
 2hgu(O) : *****LRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEA 
         :                                                                                                                          
 1vs9(J) : MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEA 
           __________________________________36____________________________________________________________________________________ 

           ______________________________                                                                                           
 2hgu(O) : KPLKVVAHAFSKSALEKLKAAGGEPVLLEA                                                                                           
         :                                                                                                                          
 1vs9(J) : KPLKVVAHAFSKSALEKLKAAGGEPVL***                                                                                           
           ______________________________                                                                                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		112.7
Translation
(A) 		19.8
Closure
(%) 		41.9
Bending Residues
( green ) 		  36 - 77
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download