2A8 Fab Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 2A8 Fab Heavy Chain
  Conformer 1
(PDB) 		1z3g (H)
  Conformer 2
(PDB) 		2dtg (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 111 1.46   5 - 117
2 97 2.55   118 - 214

Sequence


           _________________________________________________________________________________________________________________116____ 
 1z3g(H) : **QLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIHPHSGSTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARGWDVAYWGQGTLVTVSAAKTTP 
         :                                                                                                                          
 2dtg(C) : QVQLQQSGPELVKPGALVKISCKASGYTFTNYDIHWVKQRPGQGLEWIGWIYPGDGSTKYNEKFKGKATLTADKSSSTAYMHLSSLTSEKSAVYFCAREW--AYWGQGTLVTVSAAKTTA 
           _________________________________________________________________________________________________________________114____ 

           _________________________________________________________________________________________________                        
 1z3g(H) : PSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD*                        
         :                                                                                                                          
 2dtg(C) : PSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC                        
           _________________________________________________________________________________________________                        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		40.1
Translation
(A) 		-1.9
Closure
(%) 		95.0
Bending Residues
( green ) 		  116 - 118
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download