Apolipoprotein A-I

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Apolipoprotein A-I
  Conformer 1
(PDB)
1av1 (D)
  Conformer 2
(PDB)
2a01 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 38 4.39   83 - 120
2 34 2.16   49 - 82
3 20 2.35   121 - 140
4 40 4.67   145 - 184
5 26 2.88   191 - 216

Sequence


           ________________________________________________________________________________82___________________________________120 
 1av1(D) : ******************************************MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVE 
         :                                                                                                                          
 2a01(A) : DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVE 
           ________________________________________________________________________________82___________________________________120 

           ________________139________________________________________182__________________________________________________________ 
 1av1(D) : PLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKL 
         :                                                                                                                          
 2a01(A) : PLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKL 
           ________________139________________________________________182__________________________________________________________ 

           ___                                                                                                                      
 1av1(D) : NTQ                                                                                                                      
         :                                                                                                                          
 2a01(A) : NTQ                                                                                                                      
           ___                                                                                                                      

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 131.6 -6.2 100.0   82 - 85 Bending Region Analysis
1 3 88.2 2.9 49.0   120 - 121 Bending Region Analysis
4 3 177.3 15.3 99.9   139 - 146 Bending Region Analysis
4 5 141.5 3.8 90.9   182 - 192 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 4

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 5

Conformer 2 Contact:
Residue 5 ———› Residue 4

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download