Fab Fragment (Light Chain)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Fab Fragment (Light Chain)
  Conformer 1
(PDB) 		1ots (F)
  Conformer 2
(PDB) 		1ots (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 121 0.82   15 - 47   49 - 49   66 - 69   104 - 121   125 - 166   191 - 225
2 82 0.71   8 - 14   48 - 48   50 - 65   70 - 103   122 - 124   167 - 190

Sequence


           _________14_______________________________47________________65__69_______________________________103_______________121__ 
 1ini(A) : THLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISPGDSRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLAL 
         :                                                                                                                          
 1vgt(A) : **LDVCAVVPAA----------pKQYLSIGNQTILEHSVHALLAHPRVKRVVIAIS---sRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLAL 
           _________14_______________________________47________________65__69_______________________________103_______________121__ 

           ________________________________________166_____________________190______________________________________                
 1ini(A) : SETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLT                
         :                                                                                                                          
 1vgt(A) : SETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVT--eDLALAEFYL*                
           ________________________________________166_____________________190______________________________________                

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.7
Translation
(A) 		-0.1
Closure
(%) 		95.6
Bending Residues
( green ) 		  14 - 28
  47 - 50
  65 - 66
  69 - 70
  103 - 104
  121 - 122
  124 - 125
  166 - 167
  190 - 191
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download